PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0198s0420.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 392aa    MW: 44853.8 Da    PI: 6.3799
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0198s0420.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.31.5e-49371622128
                     NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                             +pGfrF+Pt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg 
  SapurV1A.0198s0420.1.p  37 MPGFRFRPTEEELIEFYLRRKVEGKHFNV-ELITFLDLYSYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGA 122
                             79***************************.89***************8778899********************************* PP

                     NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             d+ + +++++ +glkktLvfy+g+apkg +t+W+m+eyrl
  SapurV1A.0198s0420.1.p 123 DRMIRAENSRSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 162
                             **************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.42E-5436182IPR003441NAC domain
PROSITE profilePS5100553.94936183IPR003441NAC domain
PfamPF023651.6E-2438162IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MAIAAAMSHN DDQNNNNSND NTSNKDDEDD HEHDMVMPGF RFRPTEEELI EFYLRRKVEG  60
KHFNVELITF LDLYSYDPWE LPALAAIGEK EWFFYVPRDR KYRNGDRPNR VTTSGYWKAT  120
GADRMIRAEN SRSIGLKKTL VFYSGKAPKG IRTSWIMNEY RLPQHETERY RKAEISLCCV  180
YKRAGIEDHP SLPRSLPSRA SSSRGAQSDK KHQSHVTVKS FQPLLGQSSQ QIEMEKTSET  240
DANGGSDVTT ALGLSQHNIN AYHPISPSLE LPASVEEAMF LNQTKQASSS FLVPNCTNLF  300
TVTSSISSNP ADDDLHRLIS YQQADIGQQQ QQQQQQQFYL LQQHQTSQLS SMAPQSQPLP  360
FNMLPTTFPD RLWEWNQIQE SNFRDYNNPF K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-533818319165NO APICAL MERISTEM PROTEIN
1ut4_B2e-533818319165NO APICAL MERISTEM PROTEIN
1ut7_A2e-533818319165NO APICAL MERISTEM PROTEIN
1ut7_B2e-533818319165NO APICAL MERISTEM PROTEIN
4dul_A2e-533818319165NAC domain-containing protein 19
4dul_B2e-533818319165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011028443.10.0PREDICTED: NAC domain-containing protein 72
RefseqXP_011028444.10.0PREDICTED: NAC domain-containing protein 72
TrEMBLB9N0K10.0B9N0K1_POPTR; Uncharacterized protein
STRINGPOPTR_0004s23970.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72033146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-103NAC domain containing protein 35